Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNB2A, zebrafish (HEK293, His)

The EFNB2A protein is a cell surface ligand of the Eph receptor that critically regulates migration, repulsion, and adhesion in neuronal, vascular, and epithelial development. EFNB2A Protein, zebrafish (HEK293, His) is the recombinant EFNB2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EFNB2A Protein, zebrafish (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/efnb2a-protein-zebrafish-hek293-his.html

Purity

95.00

Smiles

LILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVA

Molecular Formula

30219 (Gene_ID) O73874 (L25-A222) (Accession)

Molecular Weight

Approximately 30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-669f-5p miRNA Antagomir
CIN1003-01 10 nmol

Mmu-miR-669f-5p miRNA Antagomir

Sign In for Pricing
View Details
Mmu-miR-669f-5p miRNA Antagomir
CIN1003-02 20 nmol

Mmu-miR-669f-5p miRNA Antagomir

Sign In for Pricing
View Details
Maxwell Wheel
1030465 1 Each

Maxwell Wheel

Sign In for Pricing
View Details
Rabbit Polyclonal VSTM1 Antibody
NBP3-05911-50ul 50 µL

Rabbit Polyclonal VSTM1 Antibody

Sign In for Pricing
View Details
Salicylic acid
TBW00935 25mg

Salicylic acid

Sign In for Pricing
View Details
THBS3 (NM_007112) Human Over-expression Lysate
LS007059-20ug 20 µg

THBS3 (NM_007112) Human Over-expression Lysate

Sign In for Pricing
View Details