Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNB2A, zebrafish (HEK293, His)

The EFNB2A protein is a cell surface ligand of the Eph receptor that critically regulates migration, repulsion, and adhesion in neuronal, vascular, and epithelial development. EFNB2A Protein, zebrafish (HEK293, His) is the recombinant EFNB2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EFNB2A Protein, zebrafish (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/efnb2a-protein-zebrafish-hek293-his.html

Purity

95.00

Smiles

LILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVA

Molecular Formula

30219 (Gene_ID) O73874 (L25-A222) (Accession)

Molecular Weight

Approximately 30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dual specificity mitogen-Activated Protein Kinase Kinase 5 (MAP2K5) Human ELISA Kit
D0184 96 Tests

Dual specificity mitogen-Activated Protein Kinase Kinase 5 (MAP2K5) Human ELISA Kit

Sign In for Pricing
View Details
Human Neurturin (NRTN) ELISA Kit
abx152513-01 96 Tests

Human Neurturin (NRTN) ELISA Kit

Sign In for Pricing
View Details
Human Neurturin (NRTN) ELISA Kit
abx152513-02 5x 96 Tests

Human Neurturin (NRTN) ELISA Kit

Sign In for Pricing
View Details
Human Neurturin (NRTN) ELISA Kit
abx152513-03 10x 96 Tests

Human Neurturin (NRTN) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human LTF shRNA (UAS) - Lentiviral human LTF shRNA (UAS, GFP) (100)
GTR15118245 1 Vial

Lentiviral human LTF shRNA (UAS) - Lentiviral human LTF shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Rat Dopamine D1 receptor, D1R ELISA Kit
CK-bio-14547-01 48 Tests

Rat Dopamine D1 receptor, D1R ELISA Kit

Sign In for Pricing
View Details