Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNB2A, zebrafish (HEK293, His)

The EFNB2A protein is a cell surface ligand of the Eph receptor that critically regulates migration, repulsion, and adhesion in neuronal, vascular, and epithelial development. EFNB2A Protein, zebrafish (HEK293, His) is the recombinant EFNB2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EFNB2A Protein, zebrafish (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/efnb2a-protein-zebrafish-hek293-his.html

Purity

95.00

Smiles

LILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVA

Molecular Formula

30219 (Gene_ID) O73874 (L25-A222) (Accession)

Molecular Weight

Approximately 30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pdcd2l Rat shRNA Plasmid (Locus ID 689637)
TL708028 1 Kit

Pdcd2l Rat shRNA Plasmid (Locus ID 689637)

Sign In for Pricing
View Details
Mouse Monoclonal Lipocalin-2/NGAL Antibody (56) [DyLight 680]
NBP2-41366FR 0.1 mL

Mouse Monoclonal Lipocalin-2/NGAL Antibody (56) [DyLight 680]

Sign In for Pricing
View Details
Human TMEM141 Pre-designed siRNA Set A
SI016819A 1 Each

Human TMEM141 Pre-designed siRNA Set A

Sign In for Pricing
View Details
GSK682753A 50mg
A20519-50 50 mg

GSK682753A 50mg

Sign In for Pricing
View Details
RASGRP2 Protein Vector (Human) (pPM-C-HA)
38541021 500 ng

RASGRP2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
DCX (Neuronal Migration Protein Doublecortin, Lissencephalin-X, Lis-X, Doublin, DBCN, LISX) (Biotin)
MBS6141489-01 0.1 mL

DCX (Neuronal Migration Protein Doublecortin, Lissencephalin-X, Lis-X, Doublin, DBCN, LISX) (Biotin)

Sign In for Pricing
View Details