Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNB2A, zebrafish (HEK293, His)

The EFNB2A protein is a cell surface ligand of the Eph receptor that critically regulates migration, repulsion, and adhesion in neuronal, vascular, and epithelial development. EFNB2A Protein, zebrafish (HEK293, His) is the recombinant EFNB2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EFNB2A Protein, zebrafish (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/efnb2a-protein-zebrafish-hek293-his.html

Purity

95.00

Smiles

LILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVA

Molecular Formula

30219 (Gene_ID) O73874 (L25-A222) (Accession)

Molecular Weight

Approximately 30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Carboxypeptidase A2/CPA2 Antibody (30) [mFluor Violet 450 SE]
NBP2-89531MFV450 0.1 mL

Rabbit Monoclonal Carboxypeptidase A2/CPA2 Antibody (30) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
CNOT4 Double Nickase Plasmid (m)
sc-424737-NIC 20 µg

CNOT4 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
GTPase Activating Protein Antibody
ABF6482 100 µg

GTPase Activating Protein Antibody

Sign In for Pricing
View Details
DUS1L Antibody
E308239 200 µL

DUS1L Antibody

Sign In for Pricing
View Details
Rabbit Apolipoprotein A1 (APOA1) ELISA Kit
QY-E30064 96 Tests

Rabbit Apolipoprotein A1 (APOA1) ELISA Kit

Sign In for Pricing
View Details
Human SNX4 activation kit by CRISPRa
GA105789 1 Kit

Human SNX4 activation kit by CRISPRa

Sign In for Pricing
View Details