What is the catalog number for Aβ1-40 Peptide?

The catalog number for Aβ1-40 Peptide is orb86006.

What sizes are available for Aβ1-40 Peptide?

Aβ1-40 Peptide is available in the following size(s): 100 µg, 500 µg, 1 mg.

How many pack sizes does Aβ1-40 Peptide come in?

Aβ1-40 Peptide is available in 3 different pack sizes.

Is Aβ1-40 Peptide in stock?

Aβ1-40 Peptide is currently made to order / not held in immediate stock. Contact us for lead time.

Aβ1-40 Peptide

This product is Aβ1-40 Peptide. Its protein sequence is DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV. It targets Amyloid-beta precursor protein. Purification is performed using HPLC.

Product Specifications

Product Name Alternative

β-Amyloid 1-40; beta Amyloid (1-40) ; beta-Amyloid 1-40; beta-Amyloid 1-40; Amyloid 1-40; A4; AAA; ABETA; ABPP; AD1; Alzheimers Disease Amyloid Protein; Amyloid B; Amyloid Beta A4 Protein Precursor; Amyloid Beta; Amyloid of Aging and Alzheimer Disease; APP; APPI; B Amyloid; Beta APP; Cerebral Vascular Amyloid Peptide; CTFgamma; CVAP; PN II; PN2; PreA4; Protease nexin II; A beta; A4_HUMAN.