Aβ1-40 Peptide
This product is Aβ1-40 Peptide. Its protein sequence is DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV. It targets Amyloid-beta precursor protein. Purification is performed using HPLC.
Product Specifications
Product Name Alternative
β-Amyloid 1-40; beta Amyloid (1-40) ; beta-Amyloid 1-40; beta-Amyloid 1-40; Amyloid 1-40; A4; AAA; ABETA; ABPP; AD1; Alzheimers Disease Amyloid Protein; Amyloid B; Amyloid Beta A4 Protein Precursor; Amyloid Beta; Amyloid of Aging and Alzheimer Disease; APP; APPI; B Amyloid; Beta APP; Cerebral Vascular Amyloid Peptide; CTFgamma; CVAP; PN II; PN2; PreA4; Protease nexin II; A beta; A4_HUMAN.
Field of Research
DNA / RNA Binding, DNA and RNA Research, RNA Processing
Form
Lyophilized
Storage Conditions
Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.
Notes
For research use only.
AA Sequence
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
