Aβ1-40 Peptide

This product is Aβ1-40 Peptide. Its protein sequence is DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV. It targets Amyloid-beta precursor protein. Purification is performed using HPLC.

Product Specifications

Product Name Alternative

β-Amyloid 1-40; beta Amyloid (1-40) ; beta-Amyloid 1-40; beta-Amyloid 1-40; Amyloid 1-40; A4; AAA; ABETA; ABPP; AD1; Alzheimers Disease Amyloid Protein; Amyloid B; Amyloid Beta A4 Protein Precursor; Amyloid Beta; Amyloid of Aging and Alzheimer Disease; APP; APPI; B Amyloid; Beta APP; Cerebral Vascular Amyloid Peptide; CTFgamma; CVAP; PN II; PN2; PreA4; Protease nexin II; A beta; A4_HUMAN.

Field of Research

DNA / RNA Binding, DNA and RNA Research, RNA Processing

Form

Lyophilized

Storage Conditions

Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.

Aβ1-40 Peptide

Product Specifications

Product Name Alternative

Field of Research

Form

Storage Conditions

Notes

AA Sequence

Available Sizes

Explore Other Products

ESE1 (ELF3) Mouse Monoclonal Antibody [Clone:4H6]

GL7 Rabbit pAb

OR6K2 Protein Vector (Human) (pPM-C-HA)

Rabbit Monoclonal Brorin/VWC2 Antibody (044) [Biotin]

SKOR2 Human shRNA Lentiviral Particle (Locus ID 652991)

A Synuclein (Ab 136) Antibody