Question 1

What is the catalog number for GRP Antibody Blocking Peptide?

Accepted Answer

The catalog number for GRP Antibody Blocking Peptide is orb72763.

Question 2

What sizes are available for GRP Antibody Blocking Peptide?

Accepted Answer

GRP Antibody Blocking Peptide is available in the following size(s): 500 µg.

Question 3

Is GRP Antibody Blocking Peptide in stock?

Accepted Answer

GRP Antibody Blocking Peptide is currently made to order / not held in immediate stock. Contact us for lead time.

Question 4

What is GRP Antibody Blocking Peptide used for?

Accepted Answer

This product is GRP Antibody Blocking Peptide. Its protein sequence is VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2. It targets Gastrin-releasing peptide. Purification is performed using HPLC.

Question 5

How should this product be stored?

Accepted Answer

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Question 6

Is this product animal-origin-free?

Accepted Answer

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

Question 7

Does this product need any special customs documentation to be imported to my country?

Accepted Answer

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

GRP Antibody Blocking Peptide

Product Specifications

Product Name Alternative

Form

Storage Conditions

Notes

AA Sequence

Frequently Asked Questions

Explore Other Products

hsa-miR-220c Primers

Granzyme B, Recombinant, Human, (GranzymeB, Granzyme-2, T-cell serine protease 1-3E, Cytotoxic T-lymphocyte proteinase 2, Lymphocyte protease, SECT, Cathepsin G-like 1, CTSGL1, CTLA-1, Fragmentin-2, Human lymphocyte protein, HLP, C11) discontinued

CIT2 Antibody

SPRE3 rabbit pAb

SPRE3 rabbit pAb

SPRE3 rabbit pAb