GLP-2 Antibody Blocking Peptide
This product is GLP-2 Antibody Blocking Peptide. Its protein sequence is HADGSFSDEMNILDNLAADFINWLIQTKITD. It targets Pro-glucagon. Purification is performed using HPLC.
Product Specifications
Product Name Alternative
Glucagan-like petide; glp-2; GCG; Glicentin; Glicentin related polypeptide; GLP 2; Glucagon like peptide 2; Glucagon precursor; Glucagon preproprotein; GRPP; OXM; OXY; Oxyntomodulin; GLUC_HUMAN.
Field of Research
Cancer Research, Energy Metabolism, Hormone Research, Metabolism
Form
Lyophilized
Storage Conditions
Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.
Notes
For research use only.
AA Sequence
HADGSFSDEMNILDNLAADFINWLIQTKITD
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB2808-500 1x 500 µL
Cytokeratin 18 (KRT18) (KRT18/2808R), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
56502121 3x 1.0µg DNA
DHX9P CRISPRa sgRNA lentivector (set of three targets)(Human)
Sign In for Pricing
View Details