Question 1

What is the catalog number for Adrenomedullin (1-52) Peptide?

Accepted Answer

The catalog number for Adrenomedullin (1-52) Peptide is orb72286.

Question 2

What sizes are available for Adrenomedullin (1-52) Peptide?

Accepted Answer

Adrenomedullin (1-52) Peptide is available in the following size(s): 100 µg, 500 µg, 1 mg.

Question 3

How many pack sizes does Adrenomedullin (1-52) Peptide come in?

Accepted Answer

Adrenomedullin (1-52) Peptide is available in 3 different pack sizes.

Question 4

Is Adrenomedullin (1-52) Peptide in stock?

Accepted Answer

Adrenomedullin (1-52) Peptide is currently made to order / not held in immediate stock. Contact us for lead time.

Question 5

What is Adrenomedullin (1-52) Peptide used for?

Accepted Answer

This product is Adrenomedullin (1-52) Peptide. Its protein sequence is YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 16-21 S=S. Purification is performed using HPLC.

Question 6

Is this product tested for endotoxin levels?

Accepted Answer

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.

Question 7

Can I request additional validation data, such as western blot images, for this product?

Accepted Answer

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

Question 8

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

Accepted Answer

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Adrenomedullin (1-52) Peptide

Product Specifications

Product Name Alternative

Form

Storage Conditions

Notes

AA Sequence

Available Sizes

Frequently Asked Questions

Explore Other Products

CD3e (B-B12), CF770 conjugate, 0.1mg/mL

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL

SOX9 / SRY-box 9 (PCRP-SOX9-1E5), CF405S conjugate, 0.1mg/mL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF740 conjugate, 0.1mg/mL

CD68 (LAMP4/824), CF405S conjugate, 0.1mg/mL

SOX9 / SRY-box 9 (SOX9/2387), CF594 conjugate, 0.1mg/mL