Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Amylin (1-37) Peptide

This product is Amylin (1-37) Peptide. Its protein sequence is KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2, disulfide bonds:C2=C7. Purification is performed using HPLC.

Product Specifications

Product Name Alternative

Islet amyloid polypeptide; IAPP; Amylin 1-37; Amylin (1-37)

Form

Lyophilized

Storage Conditions

Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

AA Sequence

KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2, disulfide bonds:C2=C7

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DM4
BA2323-5.1 1 mL (10 mM in DMSO)

DM4

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Assembly-complementing factor 4 (ACF4)
MBS1190011-01 0.02 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Assembly-complementing factor 4 (ACF4)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Assembly-complementing factor 4 (ACF4)
MBS1190011-02 0.02 mg (Yeast)

Recombinant Saccharomyces cerevisiae Assembly-complementing factor 4 (ACF4)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Assembly-complementing factor 4 (ACF4)
MBS1190011-03 0.1 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Assembly-complementing factor 4 (ACF4)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Assembly-complementing factor 4 (ACF4)
MBS1190011-04 0.1 mg (Yeast)

Recombinant Saccharomyces cerevisiae Assembly-complementing factor 4 (ACF4)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Assembly-complementing factor 4 (ACF4)
MBS1190011-05 0.02 mg (Baculovirus)

Recombinant Saccharomyces cerevisiae Assembly-complementing factor 4 (ACF4)

Sign In for Pricing
View Details