Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD284 Recombinant Protein

CD284 Recombinant Protein

Product Specifications

UniProt

O00206

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~60kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

ESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGST2 (NM_002413) Human Tagged ORF Clone Lentiviral Particle
RC203173L3V 200 µL

MGST2 (NM_002413) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Magic™ Membrane Protein Human OR8D1 (Olfactory receptor family 8 subfamily D member 1) Full Length
MPC3044K Each

Magic™ Membrane Protein Human OR8D1 (Olfactory receptor family 8 subfamily D member 1) Full Length

Sign In for Pricing
View Details
Anti-Human GPC2/Glypican-2 Antibody (D3), PerCP
HP003247-01 1 Each

Anti-Human GPC2/Glypican-2 Antibody (D3), PerCP

Sign In for Pricing
View Details
Anti-Human GPC2/Glypican-2 Antibody (D3), PerCP
HP003247-02 100 Tests

Anti-Human GPC2/Glypican-2 Antibody (D3), PerCP

Sign In for Pricing
View Details
Anti-CRELD1 Antibody, Mouse Monoclonal
MBS8106931-01 0.1 mL

Anti-CRELD1 Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
Anti-CRELD1 Antibody, Mouse Monoclonal
MBS8106931-02 5x 0.1 mL

Anti-CRELD1 Antibody, Mouse Monoclonal

Sign In for Pricing
View Details