Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD284 Recombinant Protein

CD284 Recombinant Protein

Product Specifications

UniProt

O00206

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~60kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

ESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey 26S proteasome non ATPase regulatory subunit 7 (PSMD7) ELISA kit
GTR10375789 96 Well

Monkey 26S proteasome non ATPase regulatory subunit 7 (PSMD7) ELISA kit

Sign In for Pricing
View Details
Contactin 6 CRISPR Activation Plasmid (m2)
sc-424755-ACT-2 20 µg

Contactin 6 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
2- (1H-Pyrrolo[2,3-b]pyridin-1-yl) acetic acid
sc-304536 1 mg

2- (1H-Pyrrolo[2,3-b]pyridin-1-yl) acetic acid

Sign In for Pricing
View Details
OLFR18 Adenovirus (Mouse)
32962054 1.0 mL

OLFR18 Adenovirus (Mouse)

Sign In for Pricing
View Details
Sekdel sequence
MBS5784103 Inquire

Sekdel sequence

Sign In for Pricing
View Details
CD11c (D1V9Y) Rabbit Monoclonal Antibody
CST 97585T 20 µL

CD11c (D1V9Y) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details