Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD284 Recombinant Protein

CD284 Recombinant Protein

Product Specifications

UniProt

O00206

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~60kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

ESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse S100A3 Protein, His, E.coli-1mg
QP13393-1mg 1mg

Recombinant Mouse S100A3 Protein, His, E.coli-1mg

Sign In for Pricing
View Details
HN1L rabbit pAb
E28PN4404 100 µL

HN1L rabbit pAb

Sign In for Pricing
View Details
UBLCP1, CT (UBLCP1, Ubiquitin-like domain-containing CTD phosphatase 1, Nuclear proteasome inhibitor UBLCP1) (MaxLight 550)
MBS6360900-01 0.1 mL

UBLCP1, CT (UBLCP1, Ubiquitin-like domain-containing CTD phosphatase 1, Nuclear proteasome inhibitor UBLCP1) (MaxLight 550)

Sign In for Pricing
View Details
UBLCP1, CT (UBLCP1, Ubiquitin-like domain-containing CTD phosphatase 1, Nuclear proteasome inhibitor UBLCP1) (MaxLight 550)
MBS6360900-02 5x 0.1 mL

UBLCP1, CT (UBLCP1, Ubiquitin-like domain-containing CTD phosphatase 1, Nuclear proteasome inhibitor UBLCP1) (MaxLight 550)

Sign In for Pricing
View Details
KRT18 Rabbit Polyclonal Antibody
orb577487 100 µL

KRT18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD31 Antibody
E301783 200 µL

CD31 Antibody

Sign In for Pricing
View Details