Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD252 Recombinant Protein

CD252 Recombinant Protein

Product Specifications

UniProt

P23510

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~15kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SUMO Conjugating Enzyme UBC9 Monoclonal Antibody
E-AB-81514-01 50 µL

Recombinant SUMO Conjugating Enzyme UBC9 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant SUMO Conjugating Enzyme UBC9 Monoclonal Antibody
E-AB-81514-02 100 µL

Recombinant SUMO Conjugating Enzyme UBC9 Monoclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Soft tissue
CR559291 5 µg

Tissue Total RNA, Soft tissue

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/1712), CF647 conjugate, 0.1mg/mL
BNC471712-500 1x 500 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/1712), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gloss Meter BMET-901
BMET-901 1 Unit

Gloss Meter BMET-901

Sign In for Pricing
View Details
OR6C2 Human Gene Knockout Kit (CRISPR)
KN423093 1 Kit

OR6C2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details