Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD252 Recombinant Protein

CD252 Recombinant Protein

Product Specifications

UniProt

P23510

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~15kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPKAPK3 (Mitogen-Activated Protein Kinase-Activated Protein Kinase 3, 3PK, MAPKAP3) (APC)
248530-APC 100 µL

MAPKAPK3 (Mitogen-Activated Protein Kinase-Activated Protein Kinase 3, 3PK, MAPKAP3) (APC)

Sign In for Pricing
View Details
Peripherin Antibody
MBS9406908-01 0.05 mL

Peripherin Antibody

Sign In for Pricing
View Details
Peripherin Antibody
MBS9406908-02 0.1 mL

Peripherin Antibody

Sign In for Pricing
View Details
Peripherin Antibody
MBS9406908-03 5x 0.1 mL

Peripherin Antibody

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A)
MBS2163940-01 0.1 mL

APC_Cy7-Linked Monoclonal Antibody to Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A)
MBS2163940-02 0.2 mL

APC_Cy7-Linked Monoclonal Antibody to Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A)

Sign In for Pricing
View Details