Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A29L Recombinant Protein

A29L Recombinant Protein

Product Specifications

UniProt

Q9YN60

Tag

His-tag

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~12kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

HMDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKHNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-NCKX1 Antibody
MBS4509317-01 0.05 mL

Rabbit anti-NCKX1 Antibody

Sign In for Pricing
View Details
Rabbit anti-NCKX1 Antibody
MBS4509317-02 0.1 mL

Rabbit anti-NCKX1 Antibody

Sign In for Pricing
View Details
Rabbit anti-NCKX1 Antibody
MBS4509317-03 5x 0.1 mL

Rabbit anti-NCKX1 Antibody

Sign In for Pricing
View Details
Na-Fmoc-Nim-trityl-D-histidine pentafluorophenyl ester ≥97%
240651-01 1 g

Na-Fmoc-Nim-trityl-D-histidine pentafluorophenyl ester ≥97%

Sign In for Pricing
View Details
Na-Fmoc-Nim-trityl-D-histidine pentafluorophenyl ester ≥97%
240651-02 5 g

Na-Fmoc-Nim-trityl-D-histidine pentafluorophenyl ester ≥97%

Sign In for Pricing
View Details
Na-Fmoc-Nim-trityl-D-histidine pentafluorophenyl ester ≥97%
240651-03 25 g

Na-Fmoc-Nim-trityl-D-histidine pentafluorophenyl ester ≥97%

Sign In for Pricing
View Details