Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A29L Recombinant Protein

A29L Recombinant Protein

Product Specifications

UniProt

Q9YN60

Tag

His-tag

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~12kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

HMDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKHNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-6822-5p agomir
HY-R02209A-01 5 nmol

Hsa-miR-6822-5p agomir

Sign In for Pricing
View Details
Hsa-miR-6822-5p agomir
HY-R02209A-02 20 nmol

Hsa-miR-6822-5p agomir

Sign In for Pricing
View Details
Recombinant Human CD121a/IL1R1 Protein, C-His
HB791021-01 50 µg

Recombinant Human CD121a/IL1R1 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human CD121a/IL1R1 Protein, C-His
HB791021-02 100 µg

Recombinant Human CD121a/IL1R1 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human CD121a/IL1R1 Protein, C-His
HB791021-03 1 mg

Recombinant Human CD121a/IL1R1 Protein, C-His

Sign In for Pricing
View Details
MicroMount Assembly; box of 20 assemblies
B-M2-150-B1A-R 20 Mounts/Base Assemblies

MicroMount Assembly; box of 20 assemblies

Sign In for Pricing
View Details