Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A35R Recombinant Protein

A35R Recombinant Protein

Product Specifications

UniProt

Q80KX2

Tag

His-tag

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~14kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

HMVRLNQCMSANEAAITDSAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYKSFEDAKANCAAESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCTLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti-ECT2 Antibody
orb18531 100 µg

Goat anti-ECT2 Antibody

Sign In for Pricing
View Details
Research Grade Anti-Human CD88/C5AR1 (MOR210)
DHD47202 100 μg

Research Grade Anti-Human CD88/C5AR1 (MOR210)

Sign In for Pricing
View Details
(1,5E,11E) -tridecatriene-7,9-diyne-3,4-diacetate
orb1684009 10 mg

(1,5E,11E) -tridecatriene-7,9-diyne-3,4-diacetate

Sign In for Pricing
View Details
CD79b (BCR-Ig beta) (PE)
C2431-06D 100 µg

CD79b (BCR-Ig beta) (PE)

Sign In for Pricing
View Details
Mouse Linker for activation of T cell, LAT ELISA Kit
MBS164462-01 48 Well

Mouse Linker for activation of T cell, LAT ELISA Kit

Sign In for Pricing
View Details
Mouse Linker for activation of T cell, LAT ELISA Kit
MBS164462-02 96 Well

Mouse Linker for activation of T cell, LAT ELISA Kit

Sign In for Pricing
View Details