Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H3L Recombinant Protein

H3L Recombinant Protein

Product Specifications

UniProt

Q3I8S1

Tag

His-tag; Sumo-Tag

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~48kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

HMAAAKTPVIVVPVIDRPPSETFPNVHEHINDQKFDDVKDNEVMQEKRDVVIVNDDPDHYKDYVFIQWTGGNIRDDDKYTHFFSGFCNTMCTEETKRNIARHLALWDSKFFIELENKNVEYVVIIENDNVIEDITFLRPVLKAIHDKKIDILQMREIITGNKVKTELVIDKDHAIFTYTGGYDVSLSAYIIRVTTALNIVDEIIKSGGLSSGFYFEIARIENEMKINRQIMDNSAKYVEHDPRLVAEHRFETMKPNFWSRIGTVAAKRYPGVMYTFTTPLISFLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLG2 Antibody
orb816179 2 mg

GLG2 Antibody

Sign In for Pricing
View Details
CDK12 3'UTR Luciferase Stable Cell Line
TU004069 1.0 mL

CDK12 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
HNRNPA3 Knockout Cell Lysate
ABC-KC0859 100 µg

HNRNPA3 Knockout Cell Lysate

Sign In for Pricing
View Details
YNL205C Antibody
orb853228 2 mg

YNL205C Antibody

Sign In for Pricing
View Details
Flag (DYKDDDDK) Epitope Tag (Biotin)
F4524-72G-Biotin 100 µL

Flag (DYKDDDDK) Epitope Tag (Biotin)

Sign In for Pricing
View Details
H-Asp (pNA) -OH·HCl
FA110774 0.25 g

H-Asp (pNA) -OH·HCl

Sign In for Pricing
View Details