Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H3L Recombinant Protein

H3L Recombinant Protein

Product Specifications

UniProt

Q3I8S1

Tag

His-tag; Sumo-Tag

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~48kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

HMAAAKTPVIVVPVIDRPPSETFPNVHEHINDQKFDDVKDNEVMQEKRDVVIVNDDPDHYKDYVFIQWTGGNIRDDDKYTHFFSGFCNTMCTEETKRNIARHLALWDSKFFIELENKNVEYVVIIENDNVIEDITFLRPVLKAIHDKKIDILQMREIITGNKVKTELVIDKDHAIFTYTGGYDVSLSAYIIRVTTALNIVDEIIKSGGLSSGFYFEIARIENEMKINRQIMDNSAKYVEHDPRLVAEHRFETMKPNFWSRIGTVAAKRYPGVMYTFTTPLISFLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIFI Dna polymerase, Thermococcus kodakarensis
HY-P78949 Inquire

HIFI Dna polymerase, Thermococcus kodakarensis

Sign In for Pricing
View Details
RASD2, ID (RASD2, TEM2, GTP-binding protein Rhes, Ras homolog enriched in striatum, Tumor endothelial marker 2) (MaxLight 550)
MBS6340445-01 0.1 mL

RASD2, ID (RASD2, TEM2, GTP-binding protein Rhes, Ras homolog enriched in striatum, Tumor endothelial marker 2) (MaxLight 550)

Sign In for Pricing
View Details
RASD2, ID (RASD2, TEM2, GTP-binding protein Rhes, Ras homolog enriched in striatum, Tumor endothelial marker 2) (MaxLight 550)
MBS6340445-02 5x 0.1 mL

RASD2, ID (RASD2, TEM2, GTP-binding protein Rhes, Ras homolog enriched in striatum, Tumor endothelial marker 2) (MaxLight 550)

Sign In for Pricing
View Details
Monkey CKB (Creatine Kinase, Brain) ELISA Kit
MBS2507571-01 24 Tests

Monkey CKB (Creatine Kinase, Brain) ELISA Kit

Sign In for Pricing
View Details
Monkey CKB (Creatine Kinase, Brain) ELISA Kit
MBS2507571-02 48 Tests

Monkey CKB (Creatine Kinase, Brain) ELISA Kit

Sign In for Pricing
View Details
Monkey CKB (Creatine Kinase, Brain) ELISA Kit
MBS2507571-03 96 Tests

Monkey CKB (Creatine Kinase, Brain) ELISA Kit

Sign In for Pricing
View Details