Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A33R Recombinant Protein

A33R Recombinant Protein

Product Specifications

UniProt

Q3I8L8

Tag

His-tag

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~16kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

HMASILNTLRFLEKTSFYNCNDSITKEKIKIKHKGMSFVFYKPKHSTVVKYLSGGGIYHDDLVVLGKVTINDLKMMLFYMDLSYHGVTSSGAIYKLGSSIDRLSLNRTIVTKVNNNYNNYNNYNNYNCYNNYNCYNYDDTFFDDDDLE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Natural Convection Oven 30 L Basic - inclusive 2 steel wire shelfs
TIN-TN30B 1 Each

Natural Convection Oven 30 L Basic - inclusive 2 steel wire shelfs

Sign In for Pricing
View Details
Lentiviral human FLYWCH1 shRNA (UAS) - Lentiviral human FLYWCH1 shRNA (UAS, RFP) (25)
GTR15091715 1 Vial

Lentiviral human FLYWCH1 shRNA (UAS) - Lentiviral human FLYWCH1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Recombinant Human immunodeficiency virus type 1 group M subtype F1 Gag-Pol polyprotein (gag-pol), partial
MBS1232448 Inquire

Recombinant Human immunodeficiency virus type 1 group M subtype F1 Gag-Pol polyprotein (gag-pol), partial

Sign In for Pricing
View Details
Mouse Monoclonal Varicella Zoster Virus Glycoprotein E Antibody (06) [DyLight 550]
NBP3-26889R 0.1 mL

Mouse Monoclonal Varicella Zoster Virus Glycoprotein E Antibody (06) [DyLight 550]

Sign In for Pricing
View Details
Yellowfever mosquito OBP22 Rabbit Polyclonal Antibody (PE)
orb2572227 200 µL

Yellowfever mosquito OBP22 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Creb1 Mouse Gene Knockout Kit (CRISPR)
KN503805 1 Kit

Creb1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details