Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A33R Recombinant Protein

A33R Recombinant Protein

Product Specifications

UniProt

Q3I8L8

Tag

His-tag

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~16kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

HMASILNTLRFLEKTSFYNCNDSITKEKIKIKHKGMSFVFYKPKHSTVVKYLSGGGIYHDDLVVLGKVTINDLKMMLFYMDLSYHGVTSSGAIYKLGSSIDRLSLNRTIVTKVNNNYNNYNNYNNYNCYNNYNCYNYDDTFFDDDDLE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DIMT1 Polyclonal Antibody
E-AB-18678-01 20 µL

DIMT1 Polyclonal Antibody

Sign In for Pricing
View Details
DIMT1 Polyclonal Antibody
E-AB-18678-02 60 µL

DIMT1 Polyclonal Antibody

Sign In for Pricing
View Details
DIMT1 Polyclonal Antibody
E-AB-18678-03 120 µL

DIMT1 Polyclonal Antibody

Sign In for Pricing
View Details
DIMT1 Polyclonal Antibody
E-AB-18678-04 200 µL

DIMT1 Polyclonal Antibody

Sign In for Pricing
View Details
Na-Fmoc-Nd-Z-L-ornithine 98+% (HPLC)
240569-01 1 g

Na-Fmoc-Nd-Z-L-ornithine 98+% (HPLC)

Sign In for Pricing
View Details
Na-Fmoc-Nd-Z-L-ornithine 98+% (HPLC)
240569-02 5 g

Na-Fmoc-Nd-Z-L-ornithine 98+% (HPLC)

Sign In for Pricing
View Details