Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

M1R Recombinant Protein

M1R Recombinant Protein

Product Specifications

UniProt

Q80KX3

Tag

His-tag; Sumo-Tag

Field of Research

Neuroscience

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~31kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

HMGAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNITVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Radixin (Rdx)
MBS948749-01 0.02 mg (E-Coli)

Recombinant Mouse Radixin (Rdx)

Sign In for Pricing
View Details
Recombinant Mouse Radixin (Rdx)
MBS948749-02 0.02 mg (Yeast)

Recombinant Mouse Radixin (Rdx)

Sign In for Pricing
View Details
Recombinant Mouse Radixin (Rdx)
MBS948749-03 0.1 mg (E-Coli)

Recombinant Mouse Radixin (Rdx)

Sign In for Pricing
View Details
Recombinant Mouse Radixin (Rdx)
MBS948749-04 0.1 mg (Yeast)

Recombinant Mouse Radixin (Rdx)

Sign In for Pricing
View Details
Recombinant Mouse Radixin (Rdx)
MBS948749-05 0.02 mg (Baculovirus)

Recombinant Mouse Radixin (Rdx)

Sign In for Pricing
View Details
Recombinant Mouse Radixin (Rdx)
MBS948749-06 0.02 mg (Mammalian-Cell)

Recombinant Mouse Radixin (Rdx)

Sign In for Pricing
View Details