Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

M1R Recombinant Protein

M1R Recombinant Protein

Product Specifications

UniProt

Q80KX3

Tag

His-tag; Sumo-Tag

Field of Research

Neuroscience

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~31kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

HMGAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNITVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GDF1 Protein Lysate
MBS8412191-01 0.02 mg

Human GDF1 Protein Lysate

Sign In for Pricing
View Details
Human GDF1 Protein Lysate
MBS8412191-02 5x 0.02 mg

Human GDF1 Protein Lysate

Sign In for Pricing
View Details
KD-Validated Anti-NFKB1 Rabbit Monoclonal Antibody
AGI1291-100 100 µL

KD-Validated Anti-NFKB1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
P2Y9 Rabbit Polyclonal Antibody (APC)
orb995818 100 µL

P2Y9 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Recombinant Human PEX2 Protein, N-His
orb2968787-01 50 µg

Recombinant Human PEX2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PEX2 Protein, N-His
orb2968787-02 100 µg

Recombinant Human PEX2 Protein, N-His

Sign In for Pricing
View Details