Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCL1A Recombinant Protein

TCL1A Recombinant Protein

Product Specifications

UniProt

P56279

Tag

His-tag

Field of Research

Cancer

Solubility

0.5M Urea, PH7.4

Molecular Weight

~17kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

0.5M Urea, pH 7.4

AA Sequence

MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Phosphatidate Phosphatase LPIN1 (LPIN1) ELISA Kit
MBS9923068-01 48 Well

Rat Phosphatidate Phosphatase LPIN1 (LPIN1) ELISA Kit

Sign In for Pricing
View Details
Rat Phosphatidate Phosphatase LPIN1 (LPIN1) ELISA Kit
MBS9923068-02 96 Well

Rat Phosphatidate Phosphatase LPIN1 (LPIN1) ELISA Kit

Sign In for Pricing
View Details
Rat Phosphatidate Phosphatase LPIN1 (LPIN1) ELISA Kit
MBS9923068-03 5x 96 Well

Rat Phosphatidate Phosphatase LPIN1 (LPIN1) ELISA Kit

Sign In for Pricing
View Details
Rat Phosphatidate Phosphatase LPIN1 (LPIN1) ELISA Kit
MBS9923068-04 10x 96 Well

Rat Phosphatidate Phosphatase LPIN1 (LPIN1) ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-CCNE2/Cyclin E2 Antibody, Affinity Purified
MBS3905416-01 0.01 mg

Rabbit anti-CCNE2/Cyclin E2 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-CCNE2/Cyclin E2 Antibody, Affinity Purified
MBS3905416-02 0.1 mg

Rabbit anti-CCNE2/Cyclin E2 Antibody, Affinity Purified

Sign In for Pricing
View Details