Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E8L Recombinant Protein

E8L Recombinant Protein

Product Specifications

UniProt

Q5IXS0

Tag

His-tag; Sumo-Tag

Field of Research

Infectious Diseases

Solubility

2M Urea, PH7.4

Molecular Weight

~39kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

2M Urea, pH 7.4

AA Sequence

HMPQQLSPINIETKKAISDARLKTLDIHYNESKPTTIQNTGKLVRINFKGGYISGGFLPNEYVLSTIHIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGIIIIAIFLQVSDHKNVYFQKIVNQLDSIRSANMSAPFDSVFYLDNLLPSTLDYFTYLGTTINHSADAAWIIFPTPINIHSDQLSKFRTLLSSSNHEGKPHYITENYRNPYKLNDDTQVYYSGEIIRAATTSPVRENYFMKWLSDLREVCFSYYQKYIEGNKLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Glutamate Receptor 1 (AMPA Subtype) (Ser845) Rabbit mAb
E2R23461 100 µL

Phospho-Glutamate Receptor 1 (AMPA Subtype) (Ser845) Rabbit mAb

Sign In for Pricing
View Details
8- (6-Aminohexyl) -amino-adenosine-3',5'-bisphosphate-ATTO-590
NU-811-590 120 µL

8- (6-Aminohexyl) -amino-adenosine-3',5'-bisphosphate-ATTO-590

Sign In for Pricing
View Details
Mouse Resistin ELISA Kit
CSB-E06886m-01 48 Tests

Mouse Resistin ELISA Kit

Sign In for Pricing
View Details
Mouse Resistin ELISA Kit
CSB-E06886m-02 96 Tests

Mouse Resistin ELISA Kit

Sign In for Pricing
View Details
Mouse Resistin ELISA Kit
CSB-E06886m-03 5x 96 Tests

Mouse Resistin ELISA Kit

Sign In for Pricing
View Details
Mouse Resistin ELISA Kit
CSB-E06886m-04 10x 96 Tests

Mouse Resistin ELISA Kit

Sign In for Pricing
View Details