Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B6R Recombinant Protein

B6R Recombinant Protein

Product Specifications

UniProt

Q773E2

Tag

His-tag; Sumo-Tag

Solubility

2M Urea, PH7.4

Molecular Weight

~45kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

2M Urea, pH 7.4

AA Sequence

HMKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDSGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGVSYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYHLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSPYL4 Rabbit Polyclonal Antibody (FITC)
orb2105133 100 µL

TSPYL4 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
CD19 (FITC), CD3 (PE), Dual Color
C2269-93A 100 Tests

CD19 (FITC), CD3 (PE), Dual Color

Sign In for Pricing
View Details
GNPDA1, NT (Glucosamine-6-phosphate Deaminase 1, Glucosamine-6-phosphate Isomerase 1, GlcN6P Deaminase 1, Oscillin, GNPI, HLN, KIAA0060) (MaxLight 550) discontinued
030999-ML550 100 µL

GNPDA1, NT (Glucosamine-6-phosphate Deaminase 1, Glucosamine-6-phosphate Isomerase 1, GlcN6P Deaminase 1, Oscillin, GNPI, HLN, KIAA0060) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Rat Orexin A ELISA Kit
MBS722392-01 48 Well

Rat Orexin A ELISA Kit

Sign In for Pricing
View Details
Rat Orexin A ELISA Kit
MBS722392-02 96 Well

Rat Orexin A ELISA Kit

Sign In for Pricing
View Details
Rat Orexin A ELISA Kit
MBS722392-03 5x 96 Well

Rat Orexin A ELISA Kit

Sign In for Pricing
View Details