Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C19L Recombinant Protein

C19L Recombinant Protein

Product Specifications

UniProt

Q5IXY0

Tag

His-tag; Sumo-Tag

Solubility

2M Urea, PH7.4

Molecular Weight

~48kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

2M Urea, pH 7.4

AA Sequence

HMWPFASVPAGAKCRLVETLPENMDFRSDHLTTFECFNEIITLAKKYIYIASFCCNPLSTTRGALIFDKLKEVSEKGIKIIVLLDERGKRNLGELQSHSPDINFITVNIDKKNNVGLLLGCFWVSDDERCYVGNASFTGGSIHTIKTLGVYSDYPPLATDLRRRFDTFKAFNSAKNSWLNLCSAACCLPVSTAYHIKNPIGGVFFTDSPEHLLGYSRDLDTDVVIDKLKSAKTSIDIEHLAIVPTTRVDGNSYYWPDIYNSIIEAAINRGVKIRLLVGNWDKNDVYSMATARSLDALCVQNDLSVKVFTIQNNTKLLIVDDEYVHITSANFDGTHYQNHGFVSFNSIDKQLVSEAKKIFERDWVSSHSKSLKILE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TestStrip™ Glucose
M1093-200 200 Strips

TestStrip™ Glucose

Sign In for Pricing
View Details
Human NHP2L1 protein
orb754787-01 50 µg

Human NHP2L1 protein

Sign In for Pricing
View Details
Human NHP2L1 protein
orb754787-02 100 µg

Human NHP2L1 protein

Sign In for Pricing
View Details
Human NHP2L1 protein
orb754787-03 200 µg

Human NHP2L1 protein

Sign In for Pricing
View Details
Human NHP2L1 protein
orb754787-04 1 mg

Human NHP2L1 protein

Sign In for Pricing
View Details
RPS17 Blocking Peptide
MBS9628139-01 1 mg

RPS17 Blocking Peptide

Sign In for Pricing
View Details