Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C19L Recombinant Protein

C19L Recombinant Protein

Product Specifications

UniProt

Q5IXY0

Tag

His-tag; Sumo-Tag

Solubility

2M Urea, PH7.4

Molecular Weight

~48kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

2M Urea, pH 7.4

AA Sequence

HMWPFASVPAGAKCRLVETLPENMDFRSDHLTTFECFNEIITLAKKYIYIASFCCNPLSTTRGALIFDKLKEVSEKGIKIIVLLDERGKRNLGELQSHSPDINFITVNIDKKNNVGLLLGCFWVSDDERCYVGNASFTGGSIHTIKTLGVYSDYPPLATDLRRRFDTFKAFNSAKNSWLNLCSAACCLPVSTAYHIKNPIGGVFFTDSPEHLLGYSRDLDTDVVIDKLKSAKTSIDIEHLAIVPTTRVDGNSYYWPDIYNSIIEAAINRGVKIRLLVGNWDKNDVYSMATARSLDALCVQNDLSVKVFTIQNNTKLLIVDDEYVHITSANFDGTHYQNHGFVSFNSIDKQLVSEAKKIFERDWVSSHSKSLKILE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RING Finger Protein 135 (RNF135, E3 Ubiquitin-protein Ligase RNF135, L13, MMFD, RIG-I E3 Ubiquitin Ligase, REUL, Riplet) (AP)
MBS6392683-01 0.1 mL

RING Finger Protein 135 (RNF135, E3 Ubiquitin-protein Ligase RNF135, L13, MMFD, RIG-I E3 Ubiquitin Ligase, REUL, Riplet) (AP)

Sign In for Pricing
View Details
RING Finger Protein 135 (RNF135, E3 Ubiquitin-protein Ligase RNF135, L13, MMFD, RIG-I E3 Ubiquitin Ligase, REUL, Riplet) (AP)
MBS6392683-02 5x 0.1 mL

RING Finger Protein 135 (RNF135, E3 Ubiquitin-protein Ligase RNF135, L13, MMFD, RIG-I E3 Ubiquitin Ligase, REUL, Riplet) (AP)

Sign In for Pricing
View Details
Protein disulfide-isomerase (P4HB) Mouse ELISA Kit
G2678 96 Tests

Protein disulfide-isomerase (P4HB) Mouse ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Spx shRNA (UAS) - Lentiviral mouse Spx shRNA (UAS, iRFP) (25)
GTR15213338 1 Vial

Lentiviral mouse Spx shRNA (UAS) - Lentiviral mouse Spx shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Flipper-TR 5
orb3134100-01 10 mg

Flipper-TR 5

Sign In for Pricing
View Details
Flipper-TR 5
orb3134100-02 50 mg

Flipper-TR 5

Sign In for Pricing
View Details