Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A36R-EEV Recombinant Protein

A36R-EEV Recombinant Protein

Product Specifications

UniProt

Q5IXM9

Tag

His-tag

Solubility

2M Urea, PH7.4

Molecular Weight

~13kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

2M Urea, pH 7.4

AA Sequence

HMYREELMPSACANGWIQYDKHCYLDTNIKMSTDNAVYQCRKLRARLPRPDTRHLRVLFSIFYKDYWVSLKKTNDKWLDINNDKDIDISKLTNFKQLNSTTDSEACYIYKSGKLVKTVCKSTQSVLCVKRFYKLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PDGF Receptor alpha/PDGFRA Antibody Picoband® (Carrier-free Conjugate)
PB9771-carrier-free 100 µg/Vial

Anti-PDGF Receptor alpha/PDGFRA Antibody Picoband® (Carrier-free Conjugate)

Sign In for Pricing
View Details
Smad1 (Ab-465) Antibody
orb127512-01 25 µg

Smad1 (Ab-465) Antibody

Sign In for Pricing
View Details
Smad1 (Ab-465) Antibody
orb127512-02 50 µg

Smad1 (Ab-465) Antibody

Sign In for Pricing
View Details
Smad1 (Ab-465) Antibody
orb127512-03 100 µg

Smad1 (Ab-465) Antibody

Sign In for Pricing
View Details
Smad1 (Ab-465) Antibody
orb127512-04 200 µg

Smad1 (Ab-465) Antibody

Sign In for Pricing
View Details
Hsa-miR-7515 inhibitor
HY-RI02403-01 5 nmol

Hsa-miR-7515 inhibitor

Sign In for Pricing
View Details