What is the catalog number for A36R-EEV Recombinant Protein?

The catalog number for A36R-EEV Recombinant Protein is orb1495093.

What sizes are available for A36R-EEV Recombinant Protein?

A36R-EEV Recombinant Protein is available in the following size(s): 500 µg, 1 mg.

How many pack sizes does A36R-EEV Recombinant Protein come in?

A36R-EEV Recombinant Protein is available in 2 different pack sizes.

Is A36R-EEV Recombinant Protein in stock?

A36R-EEV Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

A36R-EEV Recombinant Protein

Product Specifications

UniProt

Q5IXM9

Tag

His-tag

Solubility

2M Urea, PH7.4

Molecular Weight

~13kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

2M Urea, pH 7.4

AA Sequence

HMYREELMPSACANGWIQYDKHCYLDTNIKMSTDNAVYQCRKLRARLPRPDTRHLRVLFSIFYKDYWVSLKKTNDKWLDINNDKDIDISKLTNFKQLNSTTDSEACYIYKSGKLVKTVCKSTQSVLCVKRFYKLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF504199 100 µg

NMT2 Mouse Monoclonal Antibody [Clone ID: OTI1G2]

Sign In for Pricing

View Details

sc-230681 1 g

2-Thiophenecarboxylic acid hydrazide

Sign In for Pricing

View Details

LV628645 1.0 µg DNA

WDFY1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing

View Details

orb2385654 100 µL

FRMD4B Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing

View Details

ARP3337-01 10 µg

Recombinant Human Pentraxin 3 Protein

Sign In for Pricing

View Details

ARP3337-02 50 µg

Recombinant Human Pentraxin 3 Protein

Sign In for Pricing

View Details