Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A36R-EEV Recombinant Protein

A36R-EEV Recombinant Protein

Product Specifications

UniProt

Q5IXM9

Tag

His-tag

Solubility

2M Urea, PH7.4

Molecular Weight

~13kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

2M Urea, pH 7.4

AA Sequence

HMYREELMPSACANGWIQYDKHCYLDTNIKMSTDNAVYQCRKLRARLPRPDTRHLRVLFSIFYKDYWVSLKKTNDKWLDINNDKDIDISKLTNFKQLNSTTDSEACYIYKSGKLVKTVCKSTQSVLCVKRFYKLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SCTR Antibody Picoband® (Dylight488 Conjugate)
PB10096-Dylight488 100 µg

Anti-SCTR Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
FABP7 Antibody - N-terminal region
ARP33827_T100-25UL 25 µL

FABP7 Antibody - N-terminal region

Sign In for Pricing
View Details
pCR4-TOPO-PCDHGA11 Plasmid
PVT33850 2 µg

pCR4-TOPO-PCDHGA11 Plasmid

Sign In for Pricing
View Details
TOR1B, CT (TOR1B, DQ1, Torsin-1B, Torsin family 1 member B) (Biotin)
MBS6357419-01 0.2 mL

TOR1B, CT (TOR1B, DQ1, Torsin-1B, Torsin family 1 member B) (Biotin)

Sign In for Pricing
View Details
TOR1B, CT (TOR1B, DQ1, Torsin-1B, Torsin family 1 member B) (Biotin)
MBS6357419-02 5x 0.2 mL

TOR1B, CT (TOR1B, DQ1, Torsin-1B, Torsin family 1 member B) (Biotin)

Sign In for Pricing
View Details
SIAH1 Antibody - C-terminal region : Biotin (ARP38212_T100-Biotin)
ARP38212_T100-Biotin 100 µL

SIAH1 Antibody - C-terminal region : Biotin (ARP38212_T100-Biotin)

Sign In for Pricing
View Details