Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A44R Recombinant Protein

A44R Recombinant Protein

Product Specifications

UniProt

Q3I957

Tag

His-tag

Solubility

2M Urea, PH7.4

Molecular Weight

~18kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

2M Urea, pH 7.4

AA Sequence

HMDKIKITIDSKIGNVVTISYNLEKITIDVTPKKKKEKDVLLAQSVAVEEAKDVKVEEKNIIDIEDDDDMDIENTLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HTR2C, ID (HTR2C, HTR1C, 5-hydroxytryptamine receptor 2C, 5-hydroxytryptamine receptor 1C, Serotonin receptor 2C) (PE)
MBS6308836-01 0.2 mL

HTR2C, ID (HTR2C, HTR1C, 5-hydroxytryptamine receptor 2C, 5-hydroxytryptamine receptor 1C, Serotonin receptor 2C) (PE)

Sign In for Pricing
View Details
HTR2C, ID (HTR2C, HTR1C, 5-hydroxytryptamine receptor 2C, 5-hydroxytryptamine receptor 1C, Serotonin receptor 2C) (PE)
MBS6308836-02 5x 0.2 mL

HTR2C, ID (HTR2C, HTR1C, 5-hydroxytryptamine receptor 2C, 5-hydroxytryptamine receptor 1C, Serotonin receptor 2C) (PE)

Sign In for Pricing
View Details
Lentiviral mouse Actl7a shRNA (UAS) - Lentiviral mouse Actl7a shRNA (UAS, RFP) (25)
GTR15235271 1 Vial

Lentiviral mouse Actl7a shRNA (UAS) - Lentiviral mouse Actl7a shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
BJ EGFP Reporter Cell Line
ABC-RC008Z 1 Vial

BJ EGFP Reporter Cell Line

Sign In for Pricing
View Details
Human Inner Mitochondrial Membrane Peptidase 2 Like Protein (IMMP2L) ELISA Kit
MBS2707159-01 24 Strip Well

Human Inner Mitochondrial Membrane Peptidase 2 Like Protein (IMMP2L) ELISA Kit

Sign In for Pricing
View Details
Human Inner Mitochondrial Membrane Peptidase 2 Like Protein (IMMP2L) ELISA Kit
MBS2707159-02 48 Strip Well

Human Inner Mitochondrial Membrane Peptidase 2 Like Protein (IMMP2L) ELISA Kit

Sign In for Pricing
View Details