Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A44R Recombinant Protein

A44R Recombinant Protein

Product Specifications

UniProt

Q3I957

Tag

His-tag

Solubility

2M Urea, PH7.4

Molecular Weight

~18kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

2M Urea, pH 7.4

AA Sequence

HMDKIKITIDSKIGNVVTISYNLEKITIDVTPKKKKEKDVLLAQSVAVEEAKDVKVEEKNIIDIEDDDDMDIENTLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAPD Kit (Random Amplified Polymorphic DNA), BioGenomicsTM, Kit-13
R1125-13 1 Kit

RAPD Kit (Random Amplified Polymorphic DNA), BioGenomicsTM, Kit-13

Sign In for Pricing
View Details
Recombinant Geobacter lovleyi Ribonuclease PH (rph)
MBS1005120-01 0.02 mg (E-Coli)

Recombinant Geobacter lovleyi Ribonuclease PH (rph)

Sign In for Pricing
View Details
Recombinant Geobacter lovleyi Ribonuclease PH (rph)
MBS1005120-02 0.1 mg (E-Coli)

Recombinant Geobacter lovleyi Ribonuclease PH (rph)

Sign In for Pricing
View Details
Recombinant Geobacter lovleyi Ribonuclease PH (rph)
MBS1005120-03 0.02 mg (Yeast)

Recombinant Geobacter lovleyi Ribonuclease PH (rph)

Sign In for Pricing
View Details
Recombinant Geobacter lovleyi Ribonuclease PH (rph)
MBS1005120-04 0.1 mg (Yeast)

Recombinant Geobacter lovleyi Ribonuclease PH (rph)

Sign In for Pricing
View Details
Recombinant Geobacter lovleyi Ribonuclease PH (rph)
MBS1005120-05 0.02 mg (Baculovirus)

Recombinant Geobacter lovleyi Ribonuclease PH (rph)

Sign In for Pricing
View Details