Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDRG1 Recombinant Protein

NDRG1 Recombinant Protein

Product Specifications

UniProt

Q92597

Tag

His-tag

Field of Research

Neuroscience

Solubility

PBS, PH7.4

Molecular Weight

~43kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, pH 7.4

AA Sequence

HMSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSCLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

[ (3R) -3-Hydroxydodecanoyl]-L-carnitine
HY-133872 1 mg

[ (3R) -3-Hydroxydodecanoyl]-L-carnitine

Sign In for Pricing
View Details
Dystrophin Overexpression Lysate (Native) - (Dry Ice)
NBP2-10565 0.1 mg

Dystrophin Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Lentiviral mouse Upf3b shRNA (UAS) - Lentiviral mouse Upf3b shRNA (UAS, GFP) (100)
GTR15305988 1 Vial

Lentiviral mouse Upf3b shRNA (UAS) - Lentiviral mouse Upf3b shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Recombinant Rat Lysophosphatidylcholine acyltransferase 2 (Lpcat2)
MBS959330 Inquire

Recombinant Rat Lysophosphatidylcholine acyltransferase 2 (Lpcat2)

Sign In for Pricing
View Details
Recombinant Shigella Flexneri secB Protein (aa 1-155) (serotype 5b)
VAng-Lsx08157-1mgEcoli 1 mg (E. coli)

Recombinant Shigella Flexneri secB Protein (aa 1-155) (serotype 5b)

Sign In for Pricing
View Details
Rat Monoclonal PIR-A/B Antibody (404127) [DyLight 550]
FAB5308L 0.1 mL

Rat Monoclonal PIR-A/B Antibody (404127) [DyLight 550]

Sign In for Pricing
View Details