Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDRG1 Recombinant Protein

NDRG1 Recombinant Protein

Product Specifications

UniProt

Q92597

Tag

His-tag

Field of Research

Neuroscience

Solubility

PBS, PH7.4

Molecular Weight

~43kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, pH 7.4

AA Sequence

HMSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSCLE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Myeloperoxidase/MPO Antibody (CL14991)
NBP3-26846-25ul 25 µL

Mouse Monoclonal Myeloperoxidase/MPO Antibody (CL14991)

Sign In for Pricing
View Details
MiRNA Tailing Reverse Transcription Kit
R1390-01 20 Tests

MiRNA Tailing Reverse Transcription Kit

Sign In for Pricing
View Details
MiRNA Tailing Reverse Transcription Kit
R1390-02 40 Tests

MiRNA Tailing Reverse Transcription Kit

Sign In for Pricing
View Details
Chlorpromazine hydrochloride 100mg
A10206-100 100 mg

Chlorpromazine hydrochloride 100mg

Sign In for Pricing
View Details
Survivin Rabbit pAb
APA1370-01 30 µL

Survivin Rabbit pAb

Sign In for Pricing
View Details
Survivin Rabbit pAb
APA1370-02 50 μL

Survivin Rabbit pAb

Sign In for Pricing
View Details