Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nanog Recombinant Protein

Nanog Recombinant Protein

Product Specifications

UniProt

Q9H9S0

Tag

His-tag

Field of Research

Stem Cell & Developmental Biology

Solubility

0.5M Urea, PH7.4

Molecular Weight

~40kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

0.5M Urea, pH 7.4

AA Sequence

HMSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDVLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Treponema Pallidum rpsK Protein (aa 1-126) (strain SS14)
VAng-Cr1299-50gEcoli 50 µg (E. coli)

Recombinant Treponema Pallidum rpsK Protein (aa 1-126) (strain SS14)

Sign In for Pricing
View Details
PBX1 Antibody
C45433-01 50 µL

PBX1 Antibody

Sign In for Pricing
View Details
PBX1 Antibody
C45433-02 100 µL

PBX1 Antibody

Sign In for Pricing
View Details
LOC342293 antibody
70R-1790 100 ug

LOC342293 antibody

Sign In for Pricing
View Details
TUBB2A (Tubulin, beta 2A, TUBB, TUBB2, dJ40E16.7) (MaxLight 650)
253133-ML650 100 µL

TUBB2A (Tubulin, beta 2A, TUBB, TUBB2, dJ40E16.7) (MaxLight 650)

Sign In for Pricing
View Details
Prion Protein  polyclonal antibody
BS78213 50ul

Prion Protein polyclonal antibody

Sign In for Pricing
View Details