Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Angiostatin K1-3

Angiostatin K1-3 is a ~30 kDa fragment of plasminogen that has been shown to act as a potent inhibitor of angiogenesis and tumor growth in vitro and in vivo. Recombinant angiostatin is expressed in E. coli.

Product Specifications

Source

Escherichia coli.

Endotoxin

Less than 1EU/μg of rHuAngiostatin as determined by LAL method.

Purity

>95% by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active when compared to standard. The activity is assayed on anti-proliferation and anti-migration of endothelial cells in vitro and anti-angiogenesis in vivo. The specific activity of anti-migration of endothelial cells in vitro is 0.55x105Units/mg.

Form

Lyophilized from a 0.2μm filtered concentrated solution in 20mM NaAc, pH 5.5, 4% mannitol.

Molecular Weight

Approximately 30.0 KDa, a single non-glycosylated polypeptide chain containing 259 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions.

Preservative

Lyophilized from a 0.2μm filtered concentrated solution in 20mM NaAc, pH 5.5, 4% mannitol.

AA Sequence

VYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ovary tumor tissue array, including pathology grade, TNM and clinical stage, 48 cases/96 cores
OV962 48 Cases / 96 Cores

Ovary tumor tissue array, including pathology grade, TNM and clinical stage, 48 cases/96 cores

Sign In for Pricing
View Details
GNAZ Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV710490 1.0 µg DNA

GNAZ Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
gamma-D-Glutamylglycine
TRC-G597275-250MG 250 mg

gamma-D-Glutamylglycine

Sign In for Pricing
View Details
Torsin2A shRNA Plasmid (h)
sc-92871-SH 20 µg

Torsin2A shRNA Plasmid (h)

Sign In for Pricing
View Details
ZBTB9 Antibody
6131-01 0.02 mg

ZBTB9 Antibody

Sign In for Pricing
View Details
ZBTB9 Antibody
6131-02 0.1 mg

ZBTB9 Antibody

Sign In for Pricing
View Details