Recombinant Murine Fibroblast Growth Factor-basic (rMubFGF)
FGF basic (FGF-2, HBGF-2) is one of at least 22 mitogenic proteins of the FGF family, which show 35 - 60% amino acid conservation. Unlike other FGFs, FGF acidic and basic lack signal peptides and are secreted by an alternate pathway. Storage pools within the cell or on cell surface heparan sulfate proteoglycans (HSPG) are likely. The predicted 17 kDa FGF basic isoform can be located in both the cytoplasm and the nucleus and is presumed to be the form secreted. Transcription from alternate start sites produces 21 - 24 kDa forms found only in the nucleus. High and low molecular weight human FGF basic targets the expression of different genes when expressed in NIH-3T3 cells.
Product Specifications
Source
Escherichia coli.
Field of Research
Neuroscience; Stem Cell & Developmental Biology
Endotoxin
Less than 1EU/mg of rMubFGF as determined by LAL method.
Purity
>98% by SDS-PAGE and HPLC analyses.
Bioactivity
Form
Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4.
Molecular Weight
Approximately 16.2 kDa, a single non-glycosylated polypeptide chain containing 146 amino acids.
Storage Conditions
Notes
For research use only.
Applications Notes
Preservative
Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4.
AA Sequence
MPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog