Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Murine Fibroblast Growth Factor-basic (rMubFGF)

FGF basic (FGF-2, HBGF-2) is one of at least 22 mitogenic proteins of the FGF family, which show 35 - 60% amino acid conservation. Unlike other FGFs, FGF acidic and basic lack signal peptides and are secreted by an alternate pathway. Storage pools within the cell or on cell surface heparan sulfate proteoglycans (HSPG) are likely. The predicted 17 kDa FGF basic isoform can be located in both the cytoplasm and the nucleus and is presumed to be the form secreted. Transcription from alternate start sites produces 21 - 24 kDa forms found only in the nucleus. High and low molecular weight human FGF basic targets the expression of different genes when expressed in NIH-3T3 cells.

Product Specifications

Source

Escherichia coli.

Field of Research

Neuroscience; Stem Cell & Developmental Biology

Endotoxin

Less than 1EU/mg of rMubFGF as determined by LAL method.

Purity

>98% by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active when compared to standard. The ED50, as determined by the dose-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF receptors is 1x107 units/mg.

Form

Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4.

Molecular Weight

Approximately 16.2 kDa, a single non-glycosylated polypeptide chain containing 146 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions.

Preservative

Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4.

AA Sequence

MPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DSN1 (NM_001145318) Human Over-expression Lysate
LH01440V 100 µg

DSN1 (NM_001145318) Human Over-expression Lysate

Sign In for Pricing
View Details
HIC1, CT (HIC1, ZBTB29, Hypermethylated in cancer 1 protein, Zinc finger and BTB domain-containing protein 29) (Biotin) discontinued
036545-Biotin 200 µL

HIC1, CT (HIC1, ZBTB29, Hypermethylated in cancer 1 protein, Zinc finger and BTB domain-containing protein 29) (Biotin) discontinued

Sign In for Pricing
View Details
GSK 525768A
E8139-1mg 1 mg

GSK 525768A

Sign In for Pricing
View Details
GAD2 Protein Lysate (Rat) with C-HA Tag
21172036 100 µg

GAD2 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
ZNF680 antibody
70R-9009 50 ug

ZNF680 antibody

Sign In for Pricing
View Details
Recombinant human MTHFD2 protein
ATGP2972-020 20 µg

Recombinant human MTHFD2 protein

Sign In for Pricing
View Details