Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cyclin-Dependent Kinase Inhibitor 2A (rHuP16-INK4a)

Cyclin-dependent kinase inhibitors (CDKIs) are proteins that bind to and inhibit the activity of CDKs. Two major classes of CDK inhibitors have been identified. The p16 family (p15, p16, p18 and p19) binds to and inhibits the activities of CDK4 and CDK6. The p21 family (p21, p27, p28 and p57) can bind to broad range of CDK-cyclin complexes and inhibit their activities. CDKIs are capable of suppressing growth, and several lines of evidence strongly suggest that at least some CDKIs may be tumor suppressor proteins.

Product Specifications

Source

Escherichia coli

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Endotoxin

Less than 1EU/mg of rHuP16 as determined by LAL method.

Purity

>95% by SDS-PAGE and HPLC analyses.

Bioactivity

Data Not Available.

Form

Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.

Molecular Weight

Approximately 16.5 kDa, a single non-glycosylated polypeptide chain containing 156 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions.

Preservative

Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.

AA Sequence

MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEE LGHRDVARYL RAAAGGTRGS NHARIDAAEG PSDIPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL
BNC680226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL
BNC040031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL
BNC040437-100 1x 100 µL

CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MZ2E/838), CF488A conjugate, 0.1mg/mL
BNC880838-500 1x 500 µL

MAGE A1 (MZ2E/838), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 4 (KRT4) (KRT4/2804), CF640R conjugate, 0.1mg/mL
BNC402804-100 1x 100 µL

Cytokeratin 4 (KRT4) (KRT4/2804), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (CA72/733), CF647 conjugate, 0.1mg/mL
BNC470733-100 1x 100 µL

TAG-72 / CA72.4 (CA72/733), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details