Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Murine Interferon-γ (rMuIFN-γ)

Interferon-gamma (IFN-γ, also known as Type II interferon or immune interferon) is a cytokine produced primarily by T-lymphocytes and natural killer cells. The protein shares no significant homology with IFN-β or the various IFN-α family proteins. Mature IFN-γ exists as noncovalently-linked homodimers. Human IFN-γ is highly species specific and is biologically active only in human and primate cells.IFN-γ was originally characterized based on its antiviral activities. The protein also exerts antiproliferative, immunoregulatory and proinflammatory activities and is thus important in host defense mechanisms. IFN-γ induces the production of cytokines, upregulates the expression of class I and II MHC antigens, Fc receptor and leukocyte adhesion molecules. It modulates macrophage effector functions, influences isotype switching and potentiates the secretion of immunoglobulins by B cells. IFN-γ also augments TH1 cell expansion and may be required for TH1 cell differentiation.

Product Specifications

Source

Escherichia coli.

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1EU/mg of rMuIFN-γ as determined by LAL method.

Purity

>95% by SDS-PAGE and HPLC analyses

Bioactivity

Encephalomyocarditis (EMC) virus. The ED50 for this effect is typically 0.2- 0.8ng/mL, corresponding to a Specific Activity of >1.25 x 106 IU/mg.

Form

Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4, containing 5% trehalose.

Molecular Weight

Approximately 15.6 kDa, a single non-glycosylated polypeptide chain containing 134 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions.

Preservative

Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4, containing 5% trehalose.

AA Sequence

MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BactoViewTM Dead 560/570
#40108 1x 100 µL

BactoViewTM Dead 560/570

Sign In for Pricing
View Details
GRK3 Rabbit Polyclonal Antibody
HA500317 100 µL

GRK3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PER3 Antibody
8C10752-AAT 50 µg

PER3 Antibody

Sign In for Pricing
View Details
CT45A4 (NM_001017436) Human Over-expression Lysate
LC422733 20 µg

CT45A4 (NM_001017436) Human Over-expression Lysate

Sign In for Pricing
View Details
CD34 Monoclonal Antibody
AN200012P 100 µL

CD34 Monoclonal Antibody

Sign In for Pricing
View Details
Human ZNF160 activation kit by CRISPRa
GA114006 1 Kit

Human ZNF160 activation kit by CRISPRa

Sign In for Pricing
View Details