Recombinant Murine Interferon-γ (rMuIFN-γ)
Interferon-gamma (IFN-γ, also known as Type II interferon or immune interferon) is a cytokine produced primarily by T-lymphocytes and natural killer cells. The protein shares no significant homology with IFN-β or the various IFN-α family proteins. Mature IFN-γ exists as noncovalently-linked homodimers. Human IFN-γ is highly species specific and is biologically active only in human and primate cells.IFN-γ was originally characterized based on its antiviral activities. The protein also exerts antiproliferative, immunoregulatory and proinflammatory activities and is thus important in host defense mechanisms. IFN-γ induces the production of cytokines, upregulates the expression of class I and II MHC antigens, Fc receptor and leukocyte adhesion molecules. It modulates macrophage effector functions, influences isotype switching and potentiates the secretion of immunoglobulins by B cells. IFN-γ also augments TH1 cell expansion and may be required for TH1 cell differentiation.
Product Specifications
Source
Escherichia coli.
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1EU/mg of rMuIFN-γ as determined by LAL method.
Purity
>95% by SDS-PAGE and HPLC analyses
Bioactivity
Encephalomyocarditis (EMC) virus. The ED50 for this effect is typically 0.2- 0.8ng/mL, corresponding to a Specific Activity of >1.25 x 106 IU/mg.
Form
Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4, containing 5% trehalose.
Molecular Weight
Approximately 15.6 kDa, a single non-glycosylated polypeptide chain containing 134 amino acids.
Storage Conditions
Notes
For research use only.
Applications Notes
Preservative
Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4, containing 5% trehalose.
AA Sequence
MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog