Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Keratinocye Growth Factor-1 (rHuKGF-1)

Keratinocyte Growth Factor-1 (KGF-1/FGF-7) is one of 23 known members of the FGF family. All FGFs have two conserved cysteine residues and share 30 - 50% sequence identity at the amino acid level. Proteins of this family play a central role during prenatal development and postnatal growth and regeneration of variety of tissues, by promoting cellular proliferation and differentiation. KGF-1/FG-7 is a mitogen factor specific for epithelial cells and keratinocytes and signals through FGFR 2b. KGF-1/FGF-7 plays a role in kidney and lung development, angiogenesis, and wound healing.

Product Specifications

Source

Escherichia coli.

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Less than 1EU/mg of rHuKGF-1 as determined by LAL method.

Purity

>96% by SDS-PAGE and HPLC analyses.

Bioactivity

The biological activity was determined by the does-dependent stimulation of thymidine uptake by BaF3 cells expressing KGF receptors yielding an ED50 < 10ng/ml, corresponding to a specific activity of ≥ 1 x 105 units/mg.

Form

Lyophilized from a 0.2mm filtered solution in 20mM PB, pH 8.0, 1M NaCl.

Molecular Weight

Approximately 19.0 kDa, a single, non-glycosylated polypeptide chain containing 164 amino acids.

Storage Conditions

This lyophilized preparation is stable for several weeks at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions.

Preservative

Lyophilized from a 0.2mm filtered solution in 20mM PB, pH 8.0, 1M NaCl.

AA Sequence

MCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQK GIPVRGKKTK KEQKTAHFLP MAIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fc Receptor-Like Protein 2 (FCRL2) Antibody
abx376081 100 µg

Fc Receptor-Like Protein 2 (FCRL2) Antibody

Sign In for Pricing
View Details
OR4A21P Adenovirus (Human)
35153051 1.0 mL

OR4A21P Adenovirus (Human)

Sign In for Pricing
View Details
PRAMEF3, CT (PRAMEF3, PRAME family member 3) (Azide free) (HRP) discontinued
040390-HRP 200 µL

PRAMEF3, CT (PRAMEF3, PRAME family member 3) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
HMGB1P43 AAV Vector (Human) (CMV)
23533101 1 µg

HMGB1P43 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Human MAP2K4 Pre-designed siRNA Set B
SI009192B 1 Each

Human MAP2K4 Pre-designed siRNA Set B

Sign In for Pricing
View Details
CDK9 Rabbit mAb
RDSA67015 100 µL

CDK9 Rabbit mAb

Sign In for Pricing
View Details