Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MCP-2 (rHu MCP-2/CCL8)

MCP-2 and MCP-3 are two monocyte chemotactic proteins produced by human MG-63 osteosarcoma cells. Both MCP-2 and MCP-3 are members of the CC family of chemokines and share 62% and 71% amino acid sequence identity, respectively, with MCP-1.MCP-3 also shares 58% amino acid identity with MCP-2. Similarly to other CC chemokines, all three MCP proteins are monocyte chemoattractants. In addition, the three MCPs can chemoattract activated NK cells as well as CD4+ and CD8+ T lymphocytes. All three cytokines have also been shown to attract eosinophils and induce histamine secretion from basophils.

Product Specifications

Source

Escherichia coli.

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1EU/mg of rHuMCP-2/CCL8 as determined by LAL method.

Purity

>96% by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active when compared to standard. Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells.The ED50 for this effect is typically 0.03-0.1μg/mL, corresponding to a Specific Activity of >1 x 104 IU/mg.

Form

Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.

Molecular Weight

8.9 kDa, a single non-glycosylated polypeptide chain containing 76 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions.

Preservative

Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.

AA Sequence

QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR64 (ADGRG2) (NM_001184833) Human Over-expression Lysate
LC433610 20 µg

GPR64 (ADGRG2) (NM_001184833) Human Over-expression Lysate

Sign In for Pricing
View Details
DNAJA1 Recombinant Rabbit Monoclonal Antibody [PSH07-73]
HA722889 100 µL

DNAJA1 Recombinant Rabbit Monoclonal Antibody [PSH07-73]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse H-2 Antibody[M1/42]
E-AB-F1216UJ-01 25 µg

PerCP/Cyanine5.5 Anti-Mouse H-2 Antibody[M1/42]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse H-2 Antibody[M1/42]
E-AB-F1216UJ-02 100 µg

PerCP/Cyanine5.5 Anti-Mouse H-2 Antibody[M1/42]

Sign In for Pricing
View Details
L-Fucitol
TRC-F836143-5MG 5 mg

L-Fucitol

Sign In for Pricing
View Details
Tissue Total RNA, Thyroid gland
CR559414 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details