Recombinant Human MIP-4 (rHuMIP-4/CCL18)
CCL18, is a novel CC chemokine that is highly homologous to MIP-1α (61% amino acid sequence identity) . CCL18 cDNA encodes an 89 aa residue precursor protein with a 20 aa putative signal peptide that is cleaved to generate a 69 aa residue mature protein which lacks potential glycosylation sites. In vitro, CCL18 mRNA expression is induced in alternatively activated macrophages by Th2 cytokines such as IL-4, IL-10 and IL-13, and inhibited by IFN-γ. CCL18 mRNA is also expressed by GM-CSF/IL-4-induced monocyte-derived dendritic cells. In vivo, CCL18 is highly expressed in lung and placenta but is not expressed in epidermal Langerhans cells. Recombinant CCL18 has been shown to chemoattract naive T cells, but not monocytes or neutrophils.
Product Specifications
Source
Escherichia coli
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1EU/mg of rHuMIP-4/CCL18 as determined by LAL method.
Purity
>97% by SDS-PAGE and HPLC analyses.
Bioactivity
Form
Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.
Molecular Weight
7.8 kDa, a single non-glycosylated polypeptide chain containing 69 amino acids.
Storage Conditions
Notes
For research use only.
Applications Notes
Preservative
Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.
AA Sequence
AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog