Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Oncostatin-M (209a.a.) (rHuOSM 209a.a.)

Oncostatin M (OSM) is a growth and differentiation factor that participates in the regulation of neurogenesis, osteogenesis and hematopoiesis. Produced by activated T cells, monocytes and Kaposi's sarcoma cells, OSH can exert both stimulatory and inhibitory effects on cell proliferation. It stimulates the proliferation of fibroblasts, smooth muscle cells and Kaposi's sarcoma cells, but, inhibits the growth of some normal and tumor cell lines. It also promotes cytokine release (e.g. IL-6, GM-CSF and G-CSF) from endothelial cells, and enhances the expression of low-density lipoprotein receptor in hepatoma cells. OSM share several structural and functional characteristics with LIF, IL-6, and CNTF. Human OSM is active on murine cells.

Product Specifications

Source

Escherichia coli.

Endotoxin

Less than 1EU/μg of rHuOSM (209a.a.) as determined by LAL method.

Purity

>97% by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active when compared to the standard. The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 5x105units/mg.

Form

Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.

Molecular Weight

Approximately 23.9 kDa, a single non-glycosylated polypeptide chain containing 209 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions.

Preservative

Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.

AA Sequence

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF488A conjugate, 0.1mg/mL
BNC880189-100 1x 100 µL

CD74 (BU45), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF647 conjugate, 0.1mg/mL
BNC470160-100 1x 100 µL

CD20 (B9E9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF405S conjugate, 0.1mg/mL
BNC040189-100 1x 100 µL

CD74 (BU45), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
BNC471429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
BNC470806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
BNC680994-100 1x 100 µL

TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details