Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human BCA-1 (rHuBCA-1/CXCL13)

CXCL13, also known as B-lymphocyte chemoattractant (BLC), is a CXC chemokine that is constitutively expressed in secondary lymphoid organs. BCA-1 cDNA encodes a protein of 109 amino acid residues with a leader sequence of 22 residues. Mature human BCA-1 shares 64% amino acid sequence similarity with the mouse protein and 23 - 34% amino acid sequence identity with other known CXC chemokines. Recombinant or chemically synthesized BCA-1 is a potent chemoattractant for B lymphocytes but not T lymphocytes, monocytes or neutrophils. BLR1, a G protein-coupled receptor originally isolated from Burkitt’s lymphoma cells, has now been shown to be the specific receptor for BCA-1. Among cells of the hematopoietic lineages, the expression of BLR1, now designated CXCR5, is restricted to B lymphocytes and a subpopulation of T helper memory cells. Mice lacking BLR1 have been shown to lack inguinal lymph nodes. These mice were also found to have impaired development of Peyer’s patches and defective formation of primary follicles and germinal centers in the spleen as a result of the inability of B lymphocytes to migrate into B cell areas

Product Specifications

Source

Escherichia coli.

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1EU/g of rHuBCA-1/CXCL13 as determined by LAL method.

Purity

>97% by SDS-PAGE and HPLC analyses.

Bioactivity

Measured by its ability to chemoattract human CXCR5 transfected BaF3 mouse pro-B cells.The ED50 for this effect is typically 0.005-0.02 μg/mL, corresponding to a Specific Activity of >5 x 104 IU/mg.

Form

Lyophilized from a 0.2m filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.

Molecular Weight

10.3 kDa, a single non-glycosylated polypeptide chain containing 87 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions.

Preservative

Lyophilized from a 0.2m filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.

AA Sequence

VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAN1A2 (Center) Rabbit pAb
E2619622 100 µL

MAN1A2 (Center) Rabbit pAb

Sign In for Pricing
View Details
FAM82A1 Rabbit pAb, AE conjugated
orb2873782 100 µL

FAM82A1 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
TOM1L1, Control Peptide (TOM1-like Protein 1, Src-activating and Signaling Molecule Protein, SRCASM, Target of Myb-like Protein 1, OK/KNS-CL.3)
148796 100 µg

TOM1L1, Control Peptide (TOM1-like Protein 1, Src-activating and Signaling Molecule Protein, SRCASM, Target of Myb-like Protein 1, OK/KNS-CL.3)

Sign In for Pricing
View Details
Porcine ATP-binding cassette sub-family G member 8 (ABCG8) ELISA Kit
MBS7208448-01 48 Well

Porcine ATP-binding cassette sub-family G member 8 (ABCG8) ELISA Kit

Sign In for Pricing
View Details
Porcine ATP-binding cassette sub-family G member 8 (ABCG8) ELISA Kit
MBS7208448-02 96 Well

Porcine ATP-binding cassette sub-family G member 8 (ABCG8) ELISA Kit

Sign In for Pricing
View Details
Porcine ATP-binding cassette sub-family G member 8 (ABCG8) ELISA Kit
MBS7208448-03 5x 96 Well

Porcine ATP-binding cassette sub-family G member 8 (ABCG8) ELISA Kit

Sign In for Pricing
View Details