Recombinant Human Eotaxin-2 (rHuEotaxin-2/CCL24)
Eotaxin, also named MPIF-2 and Ckβ6, is a novel CC chemokine recently identified. It is produced by activated monocytes and T lymphocytes. Eotaxin-2 selectively chemoattracts cells expressing CCR3 including eosinophils, basophils, Th2 T cells, mast cells, and certain subsets of dendritic cells. Additionally, Eotaxin-2 inhibits the proliferation of multipotential hematopoietic progenitor cells. The mature protein, which also includes a C-terminal truncation, contains 78 amino acid residues (92 a.a. residues for the murine homolog, without C-terminal truncation) .
Product Specifications
Source
Escherichia coli.
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1EU/mg of rHuEotaxin-2/CCL24 as determined by LAL method.
Purity
>97% by SDS-PAGE and HPLC analyses.
Bioactivity
Form
Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
Molecular Weight
8.8 kDa, a single non-glycosylated polypeptide chain containing 78 amino acids.
Storage Conditions
Notes
For research use only.
Applications Notes
Preservative
Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
AA Sequence
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVA
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog