Recombinant Human HCC-4 (rHu HCC-4/CCL16)
Human HCC-4, also named NCC-4, liver-expressed chemokine (LEC), and lymphocyte and monocyte chemoattractant (LMC), is a novel CC chemokine identified through bioinformatics. HCC-4 cDNA encodes a 120 amino acid (aa) residue precursor protein with a 23 aa residue predicted signal peptide that is cleaved to generate a 97 aa residue mature protein. HCC-4 is distantly related to other CC chemokines, exhibiting less than 30% sequence identity. Among these CC chemokines, HCC-4 has the most similarity to HCC-1. Two potential polyadenylation signals are present on the human HCC-4 gene, and as a result, two transcripts containing approximately 1,500 base pairs and 500 base pairs have been detected. HCC-4 is expressed weakly by some lymphocytes, including NK cells, T cells, and some T cell clones. The expression of HCC-4 in monocytes is highly upregulated in the presence of IL-10.
Product Specifications
Source
Escherichia coli.
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1EU/mg of rHuHCC-4/CCL16 as determined by LAL method.
Purity
>97% by SDS-PAGE and HPLC analyses.
Bioactivity
Form
Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
Molecular Weight
11.2 kDa, a single non-glycosylated polypeptide chain containing 97 amino acids.
Storage Conditions
Notes
For research use only.
Applications Notes
Preservative
Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
AA Sequence
QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog