Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphotactin (rHuLymphotactin/XCL1)

Lymphotactin is the only known member of the C-chemokine family and signals through the receptor XCR1, formally known as GPR5. The spleen shows the highest level of lymphotactin compared to peripheral leukocytes, lung, colon and small intestine. Lymphotactin is chemotactic towards lymphocytes but not towards monocytes or neutrophils.

Product Specifications

Source

Escherichia coli

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1EU/mg of rHuCXCL13 as determined by LAL method.

Purity

>97% by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active when compared to standard. Determined by its ability to chemoattract human T cells using a concentration range of 10.0-100.0 ng/ml, corresponding to a Specific Activity of >1 x 104 IU/mg.

Form

Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.

Molecular Weight

10.0 kDa, a single non-glycosylated polypeptide chain containing 92 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions.

Preservative

Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.

AA Sequence

GSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse TGF-beta 2 CF
7346-B2-005/CF 5 µg

Recombinant Mouse TGF-beta 2 CF

Sign In for Pricing
View Details
C14orf22 sgRNA CRISPR Lentivector (Human) (Target 3)
K0296804 1.0 µg DNA

C14orf22 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Cenpq Rat shRNA Plasmid (Locus ID 363198)
TL702334 1 Kit

Cenpq Rat shRNA Plasmid (Locus ID 363198)

Sign In for Pricing
View Details
ADAM15 Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-62235R-APC-Cy5.5 100 µL

ADAM15 Recombinant Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
CAPON (NOS1AP) (NM_014697) Human Over-expression Lysate
LS009722-100ug 100 µg

CAPON (NOS1AP) (NM_014697) Human Over-expression Lysate

Sign In for Pricing
View Details
Fruit fly CG33298/dATP10B Rabbit Polyclonal Antibody (Cy3)
orb2572595 200 µL

Fruit fly CG33298/dATP10B Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details