Recombinant Human MIG (rHuMIG/CXCL9)
CXCL9, a member of the α subfamily of chemokines that lack the ELR domain, was initially identified as a lymphokine-activated gene in mouse macrophages. The CXCL9 gene is induced in macrophages and in primary glial cells of the central nervous system specifically in response to IFN-γ. CXCL9 has been shown to be a chemoattractant for activated T-lymphocytes and TIL but not for neutrophils or monocytes. The human CXCL9 cDNA encodes a 125 amino acid residue precursor protein with a 22 amino acid residue signal peptide that is cleaved to yield a 103 amino acid residue mature protein. CXCL9 has an extended carboxy-terminus containing greater than 50% basic amino acid residues and is larger than most other chemokines. A chemokine receptor (CXCR3) specific for CXCL9 and IP-10 has recently been cloned and shown to be highly expressed in IL-2-activated T-lymphocytes.
Product Specifications
Source
Escherichia coli.
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1EU/mg of rHuMIG/CXCL9 as determined by LAL method.
Purity
>97% by SDS-PAGE and HPLC analyses.
Bioactivity
Form
Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.
Molecular Weight
11.7 kDa, a single non-glycosylated polypeptide chain containing 103 amino acids.
Storage Conditions
Notes
For research use only.
Applications Notes
Preservative
Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.
AA Sequence
TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog