Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MIP-3 alpha (rHuMIP-3a/CCL20)

MIP-3 alpha/CCL20, also known as LARC (Liver and Activation-regulated Chemokine) and as Exodus, is a CC chemokine that is expressed in the liver, lymph nodes, appendix, PBL and lung and can signal through the CCR6 receptor. MIP-3 alpha is chemotactic towards lymphocytes and dendritic cells. Additionally, it promotes the adhesion of memory CD4+ T cells and inhibits colony formation of bone marrow myeloid immature progenitors.

Product Specifications

Source

Escherichia coli.

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1EU/mg of rHuMIP-3a/CCL20 as determined by LAL method.

Purity

>97% by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active when compared to standard. Determined by its ability to chemoattract human T lymphocytes using a concentration range of 10.0 -50.0 ng/ml, corresponding to a Specific Activity of >2 x 104 IU/mg.

Form

Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.

Molecular Weight

8.0 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions.

Preservative

Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.

AA Sequence

ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Siglec-9 Antibody (191240) [mFluor Violet 450 SE]
FAB1139MFV450 0.1 mL

Mouse Monoclonal Siglec-9 Antibody (191240) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Human FGF17 Protein
E40KMPH3549 20 µg

Human FGF17 Protein

Sign In for Pricing
View Details
SMYD3 Rabbit Polyclonal Antibody (Cy3)
orb2618409 100 µg

SMYD3 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
LOC498675 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV642522 1.0 µg DNA

LOC498675 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
ORAV1 (ORAOV1) (NM_153451) Human 3' UTR Clone
SC217261 10 µg

ORAV1 (ORAOV1) (NM_153451) Human 3' UTR Clone

Sign In for Pricing
View Details
Mouse 3 hydroxyisobutyryl CoA hydrolase, mitochondrial (HIBCH) ELISA Kit
GTR10333062 96 Well

Mouse 3 hydroxyisobutyryl CoA hydrolase, mitochondrial (HIBCH) ELISA Kit

Sign In for Pricing
View Details